Home > Offer to Sell > Pharmaceuticals and Biochemicals > Immunomodulator > Sermorelin Acetate;Sermorelin;elle.yang@glschina.com;ellygls@hotmail.com;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;GRF (1-29) AMIDE (HUMAN)
Sermorelin Acetate;Sermorelin;elle.yang@glschina.com;ellygls@hotmail.com;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2;GRF (1-29) AMIDE (HUMAN)
Inquiry
Post Date: | Jun 17,2014 |
Expiry Date: | Dec 14,2014 |
Detailed Description: |
Cas No. :86168-78-7
Specs:10mg, 25mg, 50mg, 100mg, 500mg, 1g,10g;95,98% Basic Information: Molecular Formula: C149H246N44O42S(elle.yang@glschina.com;ellygls@hotmail.com) Molecular Weight: 3357.88 Property: Storage Condition: −20°C Safety Information: WGK Germany: 3 We, GL Biochem , a leading manufacturer and supplier of amino acids, peptides and antibodies, has accumulated many technical knacks since our establishment in 2008. We have a group of experts armed with more than thirteen years’ experience in lab, who are still working on exploiting new structures of amino acids and peptides and their new synthesis technologies. Our products include catalogue and custom amino acids, peptides and antibodies. Our service contains IR、NMR、MS、HPLC spectrogram as required, COA(Certificate of Analysis) of products, molecular structure of products. And if you have problems involve solubility, chemical properties, molecular structure control of products, we could help you discuss with our experts. Our products: ① Amino Acids: L/D-enantiomer. N terminus, C terminus and side groups modification. Pseudoproline Dipeptides ② Peptides: a. Catalogue peptides, Pharmaceutical peptides, Cosmetic peptides and Custom peptides. b. Modification: Terminal modification: N and C terminal modification, especially N terminus fatylation Configuration modification: D-enantiomer Labeling: Fluorescence labeling and Isotope labeling Branched peptide, cyclic peptide and their combination dicyclopeptide such as E-[c(RGDyk)] Methylated peptide: asymmetrical or symmetrical Phosphorylated peptide Pesudo-dipeptide in peptide chain, for example Ser[Psi(Me,Me)Pro], Thr[Psi(Me,Me)Pro] Unusual amino acids, Homo amino acids in peptide chain ③ Others: Resins Linkers for Solid Phase Synthesis Peptide coupling reagents N-protecting reagents To be specific: Pharmaceutical peptides include: a. Vasopressin and derivatives b. Oxytocin and derivatives c. Adrenocorticotropic hormones and derivatives d. Hypothalamus-hypophysis peptide hormones e. Gastro-intestinal peptide hormones f. Antimicrobial peptide g. Others(enkephalin, thymosin, angiotensin, etc) Cosmetic peptides include dipeptide to octapeptide: Palmitoyl Tripeptide-1 Palmitoyl Tripeptide-5 Palmitoyl Tetrapeptide Palmitoyl Pentapeptide-4 Palmitoyl Oligopeptide/ Biopeptide CL Myristoyl pentapeptide-17 Acetyl Glutamyl Octapeptide-3 Acetyl Hexapeptide-8 Acetyl Hexapeptide-1 Dipeptide-2 Neuropeptide SYN-AKE Tetrapeptide Lipopeptide Acetate Choose us if you require high-quality, value-added and high-tech catalogue or custom amino acids, peptides and antibodies. Contact us if you want a considerable discount so that you can benefit more. Communicate with us if you need more details about our products. Mobile: 0086-18301993509(24 hour) Tel: 0086-21-61263384 (Direct) Fax: 0086-21-61263399 Website: http://www.glschina.com E-mail: elle.yang@glschina.com; ellyglschina@qq.com MSN: ellygls@hotmail.com QQ:2386458361 |
CAS Registry Number: | 86168-78-7 |
Synonyms: | ;GRF (1-29) amide (human);H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2;growth hormone releasing factor*fragment 1-29 ami; |
Molecular Formula: | C149H246N44O42S |
Molecular Weight: | 3357.8821 |
Molecular Structure: |
Company: | GL Biochem Ltd [ China ] |
Contact: | Elly Yang |
Tel: | 0086-21-61263384 |
Fax: | 0086-21-61263399 |
Email: | elle.yang@glschina.com |
-
Disclaimer statement:The information and data included above have been realized by the enterprises and compiled by the staff, and are subject to change without notice to you. The Chemnet makes no warranties or representations whatsoever regarding the facticity, accuracy and validity of such information and data. In order to ensure your interest, we suggest you chose the products posted by our gold suppliers or VIP members.